Keep my session open?
Ending In 
The session is expired
Twoja sesja wygasła. Zostałeś wylogowany dla własnego bezpieczeństwa.
Chcesz zalogować się jeszcze raz?

Anti-MT2 Mouse Monoclonal Antibody [clone: 6G2]

Dostawca: Abnova
Type: Primary
Antigen: MT2
Clonality: Monoclonal
Clone: 6G2
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a lambda
Reactivity: Human



Zaloguj się, aby zobaczyć swoje ceny i dostępność produktów.
  Pamiętaj mnie na tym urządzeniu
 

ZAMÓW

Rozwiń / Zwiń
Rozmiar Ilość Numer katalogowy VWR Ilość
100 µg 100 µg ABNOH00004502-M01
Wygeneruj kody kreskowe Format kodu kreskowego: 
Wygeneruj stronę katalogową PDF

SPECYFIKACJE

Antigen symbol MT2
Antigen name Metallothionein 2
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 6G2
Host Mouse
Isotype IgG2a lambda
Western Blot Yes
ELISA Yes
ImmunoFluorescence Yes
Antigen synonyms Metallothionein-2A, MT2, CES1
Gene ID 4502
Cross Adsorption non
Immunogen MT2A (NP_005944.1, 1 a.a. ~ 61 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
Form Liquid
Storage Buffer In 1x PBS, pH 7,4
Temperatura przechowywania Store at – 20 °C or lower. Aliquot to avoid repeated freezing and thawing.
Shipping Temperature Ice
Wprowadź szczegóły

Select the article for which you are looking for Certificate

Podaj numer partii. To pole jest obowiązkowe. Wpisz "X" dla VWR Chemicals, jeśli nr partii nie jest znany.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

albo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Opis Numer katalogowy Availability Jednostka Twoja Cena Price Per Ilość