Keep my session open?
Ending In 
The session is expired
Twoja sesja wygasła. Zostałeś wylogowany dla własnego bezpieczeństwa.
Chcesz zalogować się jeszcze raz?

Anti-SORL1 Mouse Monoclonal Antibody [clone: 3F2]

Dostawca: US Biological
Type: Primary
Antigen: SORL1 (sortilin-related receptor, L(DLR class) A repeats containing)
Clonality: monoclonal
Clone: 3F2
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human




 

ZAMÓW

Rozwiń / Zwiń
Rozmiar Ilość Numer katalogowy VWR Ilość
100 µg 100 µG USBI133709
Wygeneruj kody kreskowe Format kodu kreskowego: 
Wygeneruj stronę katalogową PDF

SPECYFIKACJE

Antigen symbol SORL1
Antigen name sortilin-related receptor, L(DLR class) A repeats containing
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 3F2
Host Mouse
Isotype IgG2b kappa
Western blot Yes
ELISA Yes
Amino acid number 82 to 182
Purification purified by Protein A chromatography
Sequence SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD*
Form liquid
Storage buffer PBS, pH 7,2.
Temperatura przechowywania Cool
Shipping temperature Ice
Wprowadź szczegóły

Select the article for which you are looking for Certificate

Podaj numer partii. To pole jest obowiązkowe. Wpisz "X" dla VWR Chemicals, jeśli nr partii nie jest znany.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

albo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Opis Numer katalogowy Availability Jednostka Twoja Cena Price Per Ilość
 

Nowy wygląd i odnowione zobowiązanie

Znajome funkcje i zasoby zoptymalizowane dzięki innowacyjnym rozwiązaniom firmy Avantor®. Nasza nowa marka symbolizuje elastyczność i zdolność do dostosowywania produktów do potrzeb klienta.

WIĘCEJ INFORMACJI ROZPOCZNIJ ZAKUPY