Keep my session open?
Ending In 
The session is expired
Twoja sesja wygasła. Zostałeś wylogowany dla własnego bezpieczeństwa.
Chcesz zalogować się jeszcze raz?
UWAGA! Od 8 maja 2018 r. koszty transportu ulegają zmianie. W celu uzyskania dodatkowych informacji zapraszamy do kontaktu.

Anti-SOX3 Mouse Monoclonal Antibody [clone: 1F2]

Dostawca: US Biological
Type: Primary
Antigen: SOX3 (SRY (sex determining region Y)-box 3)
Clonality: monoclonal
Clone: 1F2
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human



Zaloguj się, aby zobaczyć swoje ceny i dostępność produktów.
  Pamiętaj mnie na tym urządzeniu
 

ZAMÓW

Rozwiń / Zwiń
Rozmiar Ilość Numer katalogowy VWR Ilość
100 µg 100 µG USBI133721
Wygeneruj kody kreskowe Format kodu kreskowego: 
Wygeneruj stronę katalogową PDF

SPECYFIKACJE

Antigen symbol SOX3
Antigen name SRY (sex determining region Y)-box 3
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 1F2
Host Mouse
Isotype IgG2a kappa
Western blot Yes
ELISA Yes
Amino acid number 375 to 446
Purification purified by Protein A chromatography
Sequence KSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNGTVPLTH*
Form liquid
Storage buffer PBS, pH 7,2.
Temperatura przechowywania Cool
Shipping temperature Ice
Wprowadź szczegóły

Select the article for which you are looking for Certificate

Podaj numer partii. To pole jest obowiązkowe. Wpisz "X" dla VWR Chemicals, jeśli nr partii nie jest znany.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

albo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Opis Numer katalogowy Availability Jednostka Twoja Cena Price Per Ilość