Keep my session open?
Ending In 
The session is expired
Twoja sesja wygasła. Zostałeś wylogowany dla własnego bezpieczeństwa.
Chcesz zalogować się jeszcze raz?

Anti-SP3 Mouse Monoclonal Antibody [clone: 3H7]

Dostawca: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SP3 (Sp3 transcription factor)
Clonality: monoclonal
Clone: 3H7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human




 

ZAMÓW

Rozwiń / Zwiń
Rozmiar Ilość Numer katalogowy VWR Ilość
100 µg 100 µG USBI133736
Wygeneruj kody kreskowe Format kodu kreskowego: 
Wygeneruj stronę katalogową PDF

SPECYFIKACJE

Antigen symbol SP3
Antigen name Sp3 transcription factor
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 3H7
Host Mouse
Isotype IgG2b kappa
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 516 to 616
Purification purified by Protein A chromatography
Sequence GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL*
Form liquid
Storage buffer PBS, pH 7,2.
Temperatura przechowywania Cool
Shipping temperature Ice
Wprowadź szczegóły

Select the article for which you are looking for Certificate

Podaj numer partii. To pole jest obowiązkowe. Wpisz "X" dla VWR Chemicals, jeśli nr partii nie jest znany.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

albo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Opis Numer katalogowy Availability Jednostka Twoja Cena Price Per Ilość
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping