Keep my session open?
Ending In 
The session is expired
Twoja sesja wygasła. Zostałeś wylogowany dla własnego bezpieczeństwa.
Chcesz zalogować się jeszcze raz?

Anti-EPPIN Mouse Monoclonal Antibody [clone: 4G3]

Dostawca: US Biological
Type: Primary
Antigen: EPPIN (epididymal peptidase inhibitor)
Clonality: monoclonal
Clone: 4G3
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgM Kappa
Reactivity: Human




 

ZAMÓW

Rozwiń / Zwiń
Rozmiar Ilość Numer katalogowy VWR Ilość
200 µl 200 µl USBI133775
Wygeneruj kody kreskowe Format kodu kreskowego: 
Wygeneruj stronę katalogową PDF

SPECYFIKACJE

Antigen symbol EPPIN
Antigen name Epididymal peptidase inhibitor
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 4G3
Host Mouse
Isotype IgM kappa
Western blot Yes
ELISA Yes
Amino acid number 22 to 134
Format ascites
Sequence PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
Form liquid
Storage buffer ascites fluid.
Temperatura przechowywania Cool
Shipping temperature Ice
Wprowadź szczegóły

Select the article for which you are looking for Certificate

Podaj numer partii. To pole jest obowiązkowe. Wpisz "X" dla VWR Chemicals, jeśli nr partii nie jest znany.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

albo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Opis Numer katalogowy Availability Jednostka Twoja Cena Price Per Ilość
 

Nowy wygląd i odnowione zobowiązanie

Znajome funkcje i zasoby zoptymalizowane dzięki innowacyjnym rozwiązaniom firmy Avantor®. Nasza nowa marka symbolizuje elastyczność i zdolność do dostosowywania produktów do potrzeb klienta.

WIĘCEJ INFORMACJI ROZPOCZNIJ ZAKUPY